PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID 676753900
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Brassicaceae; Sisymbrieae; Sisymbrium
Family NF-YB
Protein Properties Length: 318aa    MW: 34918.4 Da    PI: 8.3307
Description NF-YB family protein
Gene Model
Gene Model ID Type Source Coding Sequence
676753900genomeVEGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1NF-YB169.53.9e-53135230297
      NF-YB   2 reqdrflPianvsrimkkvlPanakiskdaketvqecvsefisfvtseasdkcqrekrktingddllwalatlGfedyveplkvylkkyrelegek 97 
                reqd+++Pianv+rim+k+lPa+akis+daket+qecvse+isfvt+ea+++cqre+rkti+++d+lwa+++lGf+dyv pl+v++++yre+e+++
  676753900 135 REQDQYMPIANVIRIMRKILPAHAKISDDAKETIQECVSEYISFVTGEANERCQREQRKTITAEDILWAMSKLGFDDYVGPLNVFINRYREFETDR 230
                89*******************************************************************************************997 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:1.10.20.104.8E-47128231IPR009072Histone-fold
SuperFamilySSF471131.27E-35137231IPR009072Histone-fold
PfamPF008088.1E-26140204IPR003958Transcription factor CBF/NF-Y/archaeal histone domain
PRINTSPR006151.1E-14168186No hitNo description
PROSITE patternPS006850171187IPR003956Transcription factor, NFYB/HAP3, conserved site
PRINTSPR006151.1E-14187205No hitNo description
PRINTSPR006151.1E-14206224No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0009738Biological Processabscisic acid-activated signaling pathway
GO:0009785Biological Processblue light signaling pathway
GO:0010262Biological Processsomatic embryogenesis
GO:0045723Biological Processpositive regulation of fatty acid biosynthetic process
GO:0045893Biological Processpositive regulation of transcription, DNA-templated
GO:0005634Cellular Componentnucleus
GO:0043565Molecular Functionsequence-specific DNA binding
GO:0046982Molecular Functionprotein heterodimerization activity
Sequence ? help Back to Top
Protein Sequence    Length: 318 aa     Download sequence    Send to blast
MQLRTYVNML AKEADKASGR EACAVESGGY RVRRKDTRLE RRESTRVTIT LSFRRIGGVE  60
EGPKVTWSYG QDIALLNGLK AFPKEVAMRW DKIAAGGLNM DNQHSNSMPT VTGSIIACDD  120
KNKTIVQQQQ PCMAREQDQY MPIANVIRIM RKILPAHAKI SDDAKETIQE CVSEYISFVT  180
GEANERCQRE QRKTITAEDI LWAMSKLGFD DYVGPLNVFI NRYREFETDR GCSLRGESSS  240
FKQAFGGTGI GFHGPPQGPP PPGPYGYGML DQSMVMGGGP GGGRYYQNGA GQDGSGGGGG  300
SSSSMNGMPV FDQYGQYK
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1n1j_A5e-38135225393NF-YB
4awl_B5e-38135225494NUCLEAR TRANSCRIPTION FACTOR Y SUBUNIT BETA
4csr_A5e-38135225494NUCLEAR TRANSCRIPTION FACTOR Y SUBUNIT BETA
Search in ModeBase
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqNP_001302574.11e-121nuclear transcription factor Y subunit B-9-like
SwissprotQ9SFD81e-115NFYB9_ARATH; Nuclear transcription factor Y subunit B-9
TrEMBLD6PM211e-121D6PM21_BRANA; BnaC07g14150D protein
STRINGAT1G21970.11e-113(Arabidopsis thaliana)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM80422640
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G21970.11e-91NF-YB family protein